[Bioperl-guts-l] bioperl-live/t/data Rab1.chaos-xml,NONE,1.1

Chris Mungall cjm at pub.open-bio.org
Fri Sep 9 13:56:17 EDT 2005


Update of /home/repository/bioperl/bioperl-live/t/data
In directory pub.open-bio.org:/tmp/cvs-serv22104/t/data

Added Files:
	Rab1.chaos-xml 
Log Message:
new test file for chaos


--- NEW FILE: Rab1.chaos-xml ---
<?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE chaos PUBLIC  "-//Chaos//Custom XML//EN" "http://www.fruitfly.org/chaos-xml/dtd/chaos.dtd">
<chaos>
  <chaos_metadata>
    <chaos_version>1</chaos_version>
    <chaos_flavour>chaos</chaos_flavour>
    <focus_feature_id>gene:EMBL/GenBank/SwissProt:AE003734:52204:55287</focus_feature_id>
    <feature_unique_key>feature_id</feature_unique_key>
    <equiv_chado_release>chado_1_01</equiv_chado_release>
    <export_unixtime>1114399206</export_unixtime>
    <export_localtime>Sun Apr 24 20:20:06 2005</export_localtime>
    <export_host></export_host>
    <export_user>cjm</export_user>
    <export_perl5lib>:/Users/cjm/cvs/DBIx-DBStag:/Users/cjm/stag:/Users/cjm/cvs/sqlfairy/lib:/Users/cjm/chaos-xml/lib::/Users/cjm/cabal::/Users/cjm/biostag/lib::/Users/cjm/amigo/perl::/Users/cjm/go-db-perl::/Users/cjm/go-perl::/Users/cjm/cvs/bioperl-live::/users/cjm/cvs/gmod/XML-XORT/lib:/sw/lib/perl5:/sw/lib/perl5/darwin</export_perl5lib>
    <export_program>/Users/cjm/chaos-xml/bin/cx-genbank2chaos.pl</export_program>
  </chaos_metadata>
  <feature>
    <feature_id>AE003734.2</feature_id>
    <dbxrefstr>SEQDB:AE003734.2</dbxrefstr>
    <name>AE003734</name>
    <uniquename>Drosophila_melanogaster:AE003734.2</uniquename>
    <type>databank_entry</type>
    <featureprop>
      <type>comment</type>
      <value>On Sep 18, 2002 this sequence version replaced gi:7300718.</value>
    </featureprop>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
  </feature>
  <feature>
    <feature_id>contig:AE003734.2:55787:51703</feature_id>
    <name>contig-Rab1-500-500</name>
    <uniquename>contig-Drosophila_melanogaster:Rab1-500-500</uniquename>
    <type>contig</type>
    <featureloc>
      <nbeg>55787</nbeg>
      <nend>51703</nend>
      <strand>-1</strand>
      <srcfeature_id>AE003734.2</srcfeature_id>
    </featureloc>
    <residues>AACCTGTGCTATCTGGAGGCCATTCACAACTTCGTGGAGGTGCTCAACGAATACTTCCATAATGTGTGCGAGCTGGATCTGGTCTTCAACTTCTACAAGGTGTACAGTGTGGTGGACGAGATGTTCCTGGCGGGCGAGATCCGGGAGACCTCGCAGACGAAGGTGCTCAAGCAGCTGCTCACGCTAAATTCGCTGGAGTAGCGGCCCAATTCATACATATGTATATCGGATCTGCCAGATGCATTCCCCCAGGCGCTACACCCGCCTATCGAATCTTCTTTCATATACTATTACGCGTATTATTATTATTATCTTTAATGTGTTCTCTATGCAAACACTCAAATGTTAAAGGCCGTGTTTAGAAACAAATGATGTACCATAAGAGATTGTATGCAAAAGTTAAGTATTTTTGTTTTTATATGGGGTGTGTTAGGGGTCATTTGGCGATAATCCATATATTTTCTTCTCTGGTTCCGCCCACTCACCTCCGTAGACAAGATAATGTGTAGCCCTGGTTGGAAGAGGGCCCCGCGCATTTTCCAACACTGCCGCTAATGCCACTTCGTCATTTTTTCAGTCGCCATTGTTCTCGTTCTCGGCCGTCGAATTTGTGGAAATAAACGTATTTCCCATTTAAATTCGCTGCAATAATTACAATAGCGAACTGCAAAACACAACACAAGCCGAGTGCGTGTCGATTTCCAGTATTTCGGAACGCGCAAATCAAATAAAAACACTCTGAACAGCAGCCAGTCCAGGGCCAGAAATCGAATATTTGTTCGTGGCAAATATATAATCTTGTGAAAAAGCCAGAAAATGTCATCTGTGAATCCGGAATAGTAAGTCGTCACACGTAATTATGCGCAGTTATCTGGAGTTAAAACAGTGACTGGGCTTCCACTTCCTTTTCTGGCCTTCGAAAATAGTTTCTTTTATTTTTTCTGCGACGTCATTTCTGCTACGTTTCATTCCCAT!
TCATTATCGAGCAGCCCCACTCCACTCCCTTTTGCCCTCGTTGGCAACTCCAAAAAAACAGACCATTTGCTAAAAACAAAATACACACTCGGACCTAACAACCGACCCAATCGAGAAACCATAACCAAAACTGTGTGTTTCAGCTGGATTTCAATGTAGTGCCCACGGGCGAGGCGATGAAAAGCGCGTTCGAAACTCTCATCGGAATCTGCATATGTATAAAGTCCACACATATATACAGCGAGATCCCAGTTGACGGGCCAAATCGCTAGTCGGGCGGATGAGTCACCTGCGTGGAGAGCCTTTCCCACCCCCAGCGCAGTGCTACGTAATCAAAGGCCATTCCAGTGCTACTTAATTGCCGCTCTCACTCAAGGCAATTAAATCTGAACCGATCTTGGTTCGCACTCTCCAGAAAGCCTCCTTCAATAGCCAGCATACATGTGTGCAGAGGATTGGAACACTATCGCATATCATTCAGCAATTGGGGGTTGATGTTGGACATAGCATGATAAGATAAAGCCTAAACCAAACCGGTTTTATGTATATATTAGTATCTGCCCGACTAAACTATGCCCGCAAAACACCTCTCTAAATGTTTTGCTTGAATCAATGATTTCTAACTGATTGTCATCCAACTTATTTCCCTTTAAATGTATACTAAACCTTTTACACTCTGATTTTAAACATTTCGTCTTGTAATATCACTATCGCAAATATGCATCATCAGTTTTATTTAGATTTCTCTGAAGTTTTATATGTTTCAGCATAGGGTCTGAACTATTCCCACATCGCAGCACAAATTTATATCATTAACTATTAAATTAACTATAATTTATTAACTATATAACTATTTTATAACATTAACTATATTAACTATCTCCAAATCCACAGCGATTATCTCTTTAAGTTGCTGCTTATTGGAGACTCGGGCGTTGGAAAGTCCTGTCTTCTGTTGCGATTTGCCGATGACACATATACAGAAAGTT!
ATATCAGCACAATCGGAGTGGATTTCGTAAGCCAACCGGAAATTTGTGAAAATTCTTTATGTCTGACTCATAAACCTTTATCTTGCAGAAAATCAGGACTATAGAACTCGACGGAAAGACCATTAAACTGCAAATCGTAAGCATAAAAACGCCAGAGGCAATCTAGTCCAGAGCTAATTAGTCTGTTTACAGTGGGATACTGCTGGCCAGGAGCGCTTCCGCACCATCACGTCTTCATATTATAGGGGCGCCCATGGCATCATTGTCGTATACGATTGCACGGACCAGGAGTCTTTCAACAATGTGAAGCAGTGGCTGGAGGAGATCGAGCGGTATGCCTGTGAGAATGTCAACAAGTTGCTGGTTGGCAACAAGAGCGACTTGACCACCAAGAAAGTAGTCGACCACACCACAGCTGCGGTGCGTATATTGCTGGTTTAGTCCTGGGAATCATAGATGCACGTATATACTAATCTGGGTCTTTGTTTCCAAAATTCCAGGAGTACGCCGCCCAGTTAGGCATTCCATTCCTTGAAACTTCGGCCAAGAGCGCCACCAACGTTGAGCAGGCCTTCATGACGATGGCGGCGGAGATCAAGAATCGCGTCGGGCCGCCGTCCAGCGCCACTGACAACGCTAGCAAAGTGAAAATCGATCAAGGACGTCCAGTGGAAAACACCAAATCCGGTTGCTGCTGAATAACTCTGATTGTGAATCATTATTTTATTATACAATTAAACAAAATTTAAATATAATAAATTAAAACGGAAACCACACAATAATAATAAAACAAGCGAAACCGATGGCGGATCCACGAAATCGTAATTATAATAACTAATTCTGTAATAACAATAATGGTGAGGAATGACGAGTAGTGCGTTTGTATGATCCTAACCGTGATCCAATTCGATAAACAATTTAAGCAAATATGTATTAGGTACGTAGCCAACCAGCTCCAGATCCAGATCCCGATCCAGACTTCAGACATC!
CCCAACTAAACTCGAGCAACAAGGACATCGATCCTAATACTAACCGTCACTCTGATTTCCGCAGTTCTGTTCATAAGTAGTGCAAAGCAAGCAAATTCGGTGTAGCAATTAACCTAATATTACTTTAACCTACAATAAGAAGTTACCTATCACAGCAGCGCGAAACCATACCGAAACTAATATGTACTATTAACTACACATTAATTGAGCGCAGGCGACGGCAGGAGCAATTGTACTTGTCCTGTGTCAGCTACTACTTACCACTATGTATACATATGTATGTGTTTAAATTACAAATACAATTTTCTAAACATATTATCTCTAGCGAACGTGATCGTCACTTGAAATTTTATGTAAATCGAACCCAAAACCGAACGAACATTTTTAGATTTAACGTCGAGCGATTGTGTGTTTGAATTATCGTGTGACACAAGGGATTTGTTTAGGCACATAATTAGTGTAATAATGACGACATAGCGATGAAGTTTAATAAAAATTATTGCGTGTGCGTATTTAAATTGCAAGGTTTGGGATCAAGGACACACTTTAGTTTCGGTTTTTACTGTCGCCCGAATTTGAATCTTAATTTGACCTGAGTCTAATAAAATCGATCTGTACCGATGCCTACAAACGACTTGTTTTATTTCTTGACTTTGGAAAGATTGCAAAACTTAAGTGAAGGCCGGAACTGATCCGCACGCACCCAAATACTTGGCAGAAACTTTAAGGGCGAGGCGATTTGTGTAGAATCTTCCTGTTTTTGGAGCAAGTTTTTGGCTGATTTAAAACTTGGATCATGCCAATGTATTTAGAATATATTCAAAGCACTCTATACGAGTGCTTAGATGTTGAAGAATCAGATGTATAAATATATTTCTATTTAAAAATGTTTTATATCTGCATTATTTCACAAATCAGATTAGTTAGTGCACTGCCGTTAAGTTAACTGCACATAGGTAATCAATTTTTGTAAACCTGATACGTTGGCA!
AATCTTCTAGGATACTTACGAAAAATGTATGTATCCACTTATTTTATAAATTATATACATATATTCGGAAAGATATTTTTCTTTTTAGGACATACTCTACCTTTATGTATTGCATTGTATACATACAGGACTTATTATTTTT</residues>
  </feature>
  <feature>
    <feature_id>gene:EMBL/GenBank/SwissProt:AE003734:52204:55287</feature_id>
    <name>Rab1</name>
    <uniquename>Drosophila_melanogaster:Rab1</uniquename>
    <type>gene</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>500</nbeg>
      <nend>3584</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <feature_dbxref>
      <dbxrefstr>FLYBASE:FBgn0016700</dbxrefstr>
    </feature_dbxref>
    <featureprop>
      <type>map</type>
      <value>93D2-93D2</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>note</type>
      <value>last curated on Mon Apr 01 10:37:17 PST 2002</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>db_xref</type>
      <value>FLYBASE:FBgn0016700</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature>
    <feature_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</feature_id>
    <name>Rab1-mRNA-2</name>
    <uniquename>Drosophila_melanogaster:Rab1-mRNA-2</uniquename>
    <type>mRNA</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>500</nbeg>
      <nend>3584</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <feature_dbxref>
      <dbxrefstr>FLYBASE:FBgn0016700</dbxrefstr>
    </feature_dbxref>
    <featureprop>
      <type>product</type>
      <value>CG3320-RB</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>db_xref</type>
      <value>FLYBASE:FBgn0016700</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</subject_id>
    <object_id>gene:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature_relationship>
    <subject_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</subject_id>
    <object_id>gene:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature>
    <feature_id>AAF55873.1</feature_id>
    <name>Rab1-CDS-1</name>
    <uniquename>Drosophila_melanogaster:Rab1-CDS-1</uniquename>
    <type>polypeptide</type>
    <residues>MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVENTKSGCC</residues>
    <seqlen>205</seqlen>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>816</nbeg>
      <nend>2662</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <feature_dbxref>
      <dbxrefstr>GI:7300727</dbxrefstr>
    </feature_dbxref>
    <feature_dbxref>
      <dbxrefstr>FLYBASE:FBgn0016700</dbxrefstr>
    </feature_dbxref>
    <feature_dbxref>
      <dbxrefstr>protein:AAF55873.1</dbxrefstr>
    </feature_dbxref>
    <featureprop>
      <type>product</type>
      <value>CG3320-PA</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>note</type>
      <value>Rab1 gene product from transcript CG3320-RA</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>db_xref</type>
      <value>GI:7300727</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>db_xref</type>
      <value>FLYBASE:FBgn0016700</value>
      <rank>1</rank>
    </featureprop>
    <featureprop>
      <type>protein_id</type>
      <value>AAF55873.1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>translation</type>
      <value>MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATDNASKVKIDQGRPVENTKSGCC</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>codon_start</type>
      <value>1</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>AAF55873.1</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>derives_from</type>
  </feature_relationship>
  <feature>
    <feature_id>AAN13857.1</feature_id>
    <name>Rab1-CDS-2</name>
    <uniquename>Drosophila_melanogaster:Rab1-CDS-2</uniquename>
    <type>polypeptide</type>
    <residues>MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAVRILLV</residues>
    <seqlen>146</seqlen>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>816</nbeg>
      <nend>2405</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <feature_dbxref>
      <dbxrefstr>GI:23171868</dbxrefstr>
    </feature_dbxref>
    <feature_dbxref>
      <dbxrefstr>FLYBASE:FBgn0016700</dbxrefstr>
    </feature_dbxref>
    <feature_dbxref>
      <dbxrefstr>protein:AAN13857.1</dbxrefstr>
    </feature_dbxref>
    <featureprop>
      <type>product</type>
      <value>CG3320-PB</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>note</type>
      <value>Rab1 gene product from transcript CG3320-RB</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>db_xref</type>
      <value>GI:23171868</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>db_xref</type>
      <value>FLYBASE:FBgn0016700</value>
      <rank>1</rank>
    </featureprop>
    <featureprop>
      <type>protein_id</type>
      <value>AAN13857.1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>translation</type>
      <value>MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAVRILLV</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>codon_start</type>
      <value>1</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>AAN13857.1</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>derives_from</type>
  </feature_relationship>
  <feature>
    <feature_id>exon:EMBL/GenBank/SwissProt:AE003734:52204:53323</feature_id>
    <name>Rab1-exon-1</name>
    <uniquename>Drosophila_melanogaster:Rab1-exon-1</uniquename>
    <type>exon</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>2464</nbeg>
      <nend>3584</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:52204:53323</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature>
    <feature_id>exon:EMBL/GenBank/SwissProt:AE003734:52204:53631</feature_id>
    <name>Rab1-exon-6</name>
    <uniquename>Drosophila_melanogaster:Rab1-exon-6</uniquename>
    <type>exon</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>2156</nbeg>
      <nend>3584</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:52204:53631</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature>
    <feature_id>exon:EMBL/GenBank/SwissProt:AE003734:53404:53631</feature_id>
    <name>Rab1-exon-2</name>
    <uniquename>Drosophila_melanogaster:Rab1-exon-2</uniquename>
    <type>exon</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>2156</nbeg>
      <nend>2384</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:53404:53631</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature>
    <feature_id>exon:EMBL/GenBank/SwissProt:AE003734:53688:53735</feature_id>
    <name>Rab1-exon-3</name>
    <uniquename>Drosophila_melanogaster:Rab1-exon-3</uniquename>
    <type>exon</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>2052</nbeg>
      <nend>2100</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <featureprop>
      <type>id</type>
      <value>exon:EMBL/GenBank/SwissProt:AE003734:53688:53735</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:53688:53735</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:53688:53735</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature>
    <feature_id>exon:EMBL/GenBank/SwissProt:AE003734:53798:53918</feature_id>
    <name>Rab1-exon-4</name>
    <uniquename>Drosophila_melanogaster:Rab1-exon-4</uniquename>
    <type>exon</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>1869</nbeg>
      <nend>1990</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <featureprop>
      <type>id</type>
      <value>exon:EMBL/GenBank/SwissProt:AE003734:53798:53918</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:53798:53918</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:53798:53918</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature>
    <feature_id>exon:EMBL/GenBank/SwissProt:AE003734:54949:55287</feature_id>
    <name>Rab1-exon-5</name>
    <uniquename>Drosophila_melanogaster:Rab1-exon-5</uniquename>
    <type>exon</type>
    <organismstr>Drosophila melanogaster (fruit fly)</organismstr>
    <featureloc>
      <srcfeature_id>contig:AE003734.2:55787:51703</srcfeature_id>
      <nbeg>500</nbeg>
      <nend>839</nend>
      <strand>-1</strand>
      <rank>0</rank>
    </featureloc>
    <featureprop>
      <type>id</type>
      <value>exon:EMBL/GenBank/SwissProt:AE003734:54949:55287</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>gene</type>
      <value>Rab1</value>
      <rank>0</rank>
    </featureprop>
    <featureprop>
      <type>locus_tag</type>
      <value>CG3320</value>
      <rank>0</rank>
    </featureprop>
  </feature>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:54949:55287</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
  <feature_relationship>
    <subject_id>exon:EMBL/GenBank/SwissProt:AE003734:54949:55287</subject_id>
    <object_id>mRNA:EMBL/GenBank/SwissProt:AE003734:52204:55287</object_id>
    <type>part_of</type>
  </feature_relationship>
</chaos>



More information about the Bioperl-guts-l mailing list