[Bioperl-guts-l] bioperl-live/t/data test.fasta,1.2,1.3

Senduran Balasubramaniam sendu at dev.open-bio.org
Tue Jun 26 08:49:30 EDT 2007


Update of /home/repository/bioperl/bioperl-live/t/data
In directory dev.open-bio.org:/tmp/cvs-serv16776/t/data

Modified Files:
	test.fasta 
Log Message:
removed empty lines at start to avoid meaningless diff in new SeqIO test

Index: test.fasta
===================================================================
RCS file: /home/repository/bioperl/bioperl-live/t/data/test.fasta,v
retrieving revision 1.2
retrieving revision 1.3
diff -C2 -d -r1.2 -r1.3
*** test.fasta	10 Mar 2003 08:34:20 -0000	1.2
--- test.fasta	26 Jun 2007 12:49:28 -0000	1.3
***************
*** 1,4 ****
- 
- 
  >roa1_drome Rea guano receptor type III >> 0.1
  MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWGNIVDVV
--- 1,2 ----



More information about the Bioperl-guts-l mailing list