[Bioperl-guts-l] bioperl-live/t/data frac_problems3.blast, NONE, 1.1

Senduran Balasubramaniam sendu at dev.open-bio.org
Wed Mar 7 09:35:29 EST 2007


Update of /home/repository/bioperl/bioperl-live/t/data
In directory dev.open-bio.org:/tmp/cvs-serv12578/t/data

Added Files:
	frac_problems3.blast 
Log Message:
test data for bug 2193

--- NEW FILE: frac_problems3.blast ---
BLASTP 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PAO1/1/1119519/1118158
         (453 letters)

Database: AES1.pep 
           7167 sequences; 1,831,049 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AES1/1/1154592/1158227 putative exonuclease {AES_1265} {PAN04385}      47   2e-06

>AES1/1/1154592/1158227 putative exonuclease {AES_1265} {PAN04385}
          Length = 1211

 Score = 47.4 bits (111), Expect = 2e-06
 Identities = 52/195 (26%), Positives = 88/195 (45%), Gaps = 24/195 (12%)

Query: 15  GLNAQLETSREAYQQLGERHARFAGEVAALRREAE---LMGEERQRASQAEARWASER-- 69
           GL     + RE   Q  +      G++AAL R+ +   L  E R     A+  W ++R  
Sbjct: 647 GLREGYSSQRERLNQSRQEQQELTGQLAALDRQLDQWTLPEELRLLQPSAQLEWLAQRLD 706

Query: 70  --QGREEELRR-----LASERAA--LAAELREQQESHQQRLTDLQSARDELRAQFAELAG 120
              G+ ++ +R     +A +R    L  ELR  +   QQR    Q A  E R ++  L  
Sbjct: 707 DLAGQRQQCQRDFDRLIARQRQTQQLQQELRAAETILQQR----QQALTEQRQRYEHLQQ 762

Query: 121 KIFDEREQRFAETSQQRLGQ-MLDPLKERIQAFEKRVEESYQQEARERFSLSKELERLQQ 179
           ++ ++ +Q     S +   +   DPL+   QA  + +E+  QQ+AR    L +  +RLQ+
Sbjct: 763 QVEEDSQQLRPLLSNEHWQRWQADPLRT-FQALGESIEQRRQQQAR----LQQIEQRLQE 817

Query: 180 LNLRLGEEATNLTRA 194
           L  R  E +  L ++
Sbjct: 818 LKQRCDESSWQLKQS 832



 Score = 44.7 bits (104), Expect = 2e-05
 Identities = 55/217 (25%), Positives = 97/217 (44%), Gaps = 21/217 (9%)

Query: 4    ERLATAQLAQDGLNAQLETSREAYQ-----QLGERHARFAGEVAALRREAEL--MGEERQ 56
            E  A A+LA+  LN +L      +      QL   HA  A + A    +A L  + EE+ 
Sbjct: 843  EERAQAELAE--LNGRLGAHLGQHACAQDWQLSLEHAAQAAQSAVETLQAPLDSLREEQL 900

Query: 57   RASQAEARWASERQGREEELRRLASERAALAAELREQQES-HQQRLTDLQSARDELRAQF 115
            R ++A      +RQ +++E +RL ++  A     RE+Q++    RL  L    +E   Q+
Sbjct: 901  RLAEALEHLQQQRQRQQDEFQRLQADWQA----WRERQDNLDDSRLDALLGLSEEQATQW 956

Query: 116  AELAGKIFDEREQRFAETSQQRLGQMLDPLKERIQAFEKRVEESYQQEARERFSLSKE-- 173
             E   ++  E   R      +R  Q+L   ++R +   + +E++ +Q+ RER + S++  
Sbjct: 957  REQLQRL-QEEITRQQTLEAERQAQLLQHRRQRPETDREALEDNLRQQ-RERLAASEQAY 1014

Query: 174  ---LERLQQLNLRLGEEATNLTRALKGQKTQGNWGEL 207
                 +LQ  N R  +    L    + +     WG L
Sbjct: 1015 LDTYSQLQADNQRREQSQALLAELERARAEFRRWGRL 1051



 Score = 39.7 bits (91), Expect = 5e-04
 Identities = 63/231 (27%), Positives = 99/231 (42%), Gaps = 25/231 (10%)

Query: 14  DGLNAQLETSREAYQQLGERHARFAGEVAALRREAELMGEERQRASQAEAR--WASERQ- 70
           D    QLE   E    L E+ AR AG  AAL   A+   +E+Q   + E +  W +E Q 
Sbjct: 213 DEQRKQLEQRLEGSLPLAEQ-AR-AGLEAALESHAQARLQEQQALQRLEGQQQWFTEEQR 270

Query: 71  ---GREEELRRLASERAALAAELREQQESHQ--QRLTDLQSARDELRAQFAELAGKIFDE 125
                E    +LA  R A  A L  ++E+ Q  +RL  ++   + L+    EL      E
Sbjct: 271 LLQSCEHAQGQLAEARQAWDA-LATERETLQWLERLAPVRGLIERLKQLEQELR---HSE 326

Query: 126 REQRFAETSQQRLGQMLDPLKERIQAFEKRVEESYQQEARERFSLSKELERLQQLNLRLG 185
           ++QR   T QQ  G       ER+Q  + R++E+ +++A+    L +    L++   +L 
Sbjct: 327 QQQR-QRTEQQAAGA------ERLQGLQARLQEARERQAQADNHLRQAQAPLREA-FQLE 378

Query: 186 EEATNLTRALKGQK---TQGNWGELVLERVLEHAGLEKGREYETQVSLKGA 233
            EA  L R L  ++    Q N              +E+ R    Q  L+ A
Sbjct: 379 SEARRLERTLAERQELHRQSNQRHAQQSDAARQLDMEQQRHVAEQAQLQAA 429



 Score = 39.7 bits (91), Expect = 5e-04
 Identities = 58/232 (25%), Positives = 96/232 (41%), Gaps = 50/232 (21%)

Query: 5   RLATAQLAQDGLNAQLETSR------------EAYQQLGERHARFAGEVAALRREAELMG 52
           +LA A+ A D L  + ET +            E  +QL E+  R + +    R E +  G
Sbjct: 281 QLAEARQAWDALATERETLQWLERLAPVRGLIERLKQL-EQELRHSEQQQRQRTEQQAAG 339

Query: 53  EERQRASQAEARWASERQGREE-----------ELRRLASERAALAAELREQQESHQQRL 101
            ER +  QA  + A ERQ + +           E  +L SE   L   L E+QE H+Q  
Sbjct: 340 AERLQGLQARLQEARERQAQADNHLRQAQAPLREAFQLESEARRLERTLAERQELHRQ-- 397

Query: 102 TDLQSARDELRAQFAELAGKIFDEREQRFAETSQQR-----------LGQMLDPLKERIQ 150
                  ++  AQ ++ A ++  E+++  AE +Q +           LG      + ++ 
Sbjct: 398 ------SNQRHAQQSDAARQLDMEQQRHVAEQAQLQAALRDSQTLAALGDAWVTHQGQLA 451

Query: 151 AFEKRVEESYQQEA------RERFSLSKELERLQ-QLNLRLGEEATNLTRAL 195
           AF +R + + + +A      +      + LERLQ Q     G E  +L   L
Sbjct: 452 AFVQRRQRALESQAQLPELEKSLAHAGEPLERLQAQWTALHGSEPDDLAARL 503



 Score = 38.9 bits (89), Expect = 9e-04
 Identities = 44/150 (29%), Positives = 61/150 (40%), Gaps = 23/150 (15%)

Query: 56  QRASQAEARWASERQGREEELRRLASERAALAAELREQQESHQQRLTDLQSARDELRAQ- 114
           QRASQA+ +     Q  E  L      RA L A L    ESH Q     Q A   L  Q 
Sbjct: 207 QRASQADEQRKQLEQRLEGSLPLAEQARAGLEAAL----ESHAQARLQEQQALQRLEGQQ 262

Query: 115 --FAE----------LAGKIFDEREQRFAETSQQRLGQMLDPLK------ERIQAFEKRV 156
             F E            G++ + R+   A  +++   Q L+ L       ER++  E+ +
Sbjct: 263 QWFTEEQRLLQSCEHAQGQLAEARQAWDALATERETLQWLERLAPVRGLIERLKQLEQEL 322

Query: 157 EESYQQEARERFSLSKELERLQQLNLRLGE 186
             S QQ+ +     +   ERLQ L  RL E
Sbjct: 323 RHSEQQQRQRTEQQAAGAERLQGLQARLQE 352



 Score = 37.4 bits (85), Expect = 0.003
 Identities = 74/300 (24%), Positives = 121/300 (40%), Gaps = 38/300 (12%)

Query: 2   LGERLATAQLAQDGLNAQLETSREAYQQLGERH--ARFAGEV--AALRREAELMGEERQR 57
           L  RL   +   D L  Q    +E  Q L +R   AR  GE+    + +E  L+  +RQ 
Sbjct: 499 LAARLVELRRQTDSLERQQALHKEWQQVLDQRAGLARRLGELDQRMVEQEQALLDLKRQG 558

Query: 58  ASQAEARWASER--QGREEELRRLASERAALAAELREQQ-ESHQQRLTDLQSARDELRAQ 114
           +  AE   A+E+  Q   E L+R    R+A   +LR    +     +   Q        Q
Sbjct: 559 SQCAEEVKAAEQALQVTRELLQRQRLARSASVEQLRAGLVDGEACPVCGSQEHPYHHSEQ 618

Query: 115 FAELAGKIFDEREQRFAETSQQRLGQMLDPLKERIQAFEKRVEESYQQEAR--------- 165
                G+  D++EQ  AE S +RL Q L  L+E   +  +R+ +S Q++           
Sbjct: 619 LLAALGE-HDDQEQVRAEQSLERLRQTLVGLREGYSSQRERLNQSRQEQQELTGQLAALD 677

Query: 166 ---ERFSLSKELERLQQLNLRLGEEATNLTRALKGQKTQGNWGELVLERVLEHAGLEKGR 222
              ++++L +EL RL Q + +L   A  L   L GQ+ Q        +R  +     + +
Sbjct: 678 RQLDQWTLPEEL-RLLQPSAQLEWLAQRLD-DLAGQRQQ-------CQRDFDRLIARQRQ 728

Query: 223 EYETQVSLKGAEGERFQPDVLIRLPGDKQVVVDAKVSLTAYQQYIAADDDLLRQQALKQH 282
             + Q  L+ AE           L   +Q + + +      QQ +  D   LR     +H
Sbjct: 729 TQQLQQELRAAE---------TILQQRQQALTEQRQRYEHLQQQVEEDSQQLRPLLSNEH 779


More information about the Bioperl-guts-l mailing list