[Bioperl-l] blastall problem
DeeGee
gdorjee at hotmail.com
Thu Apr 5 23:26:16 EDT 2007
hi Torsten,
blastall -p blastp -i result/fasta.faa -d /export/home/database/nr works
perfectly fine on the command line, and the 'fasta.faa' is in fasta format:
>gi|18676474|dbj|BAB84889.1| FLJ00134 protein [Homo sapiens]
HLSAQKASVGPESVSGLGTRTWPRVSCEVTVQCWPGCHLKVGGFKMAPWQGVGRRPWFLTWGPLCGAASVSPSMTVASSQ
QGWDCTAGRRWLGEGEIEALAQVSEFKTVLSFQGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMIPLAGTAPGAEGPA
PGDSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGEKPHACPECGKAFRRKEHLRRHR
DTHPGSPGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIHGRAAAS
AQGAVAPGPDGGGPFPPWPLG
it seems like i'm just one bloody step away from success. ^ ^* can't figure
out the prob.
thanks for your help.
Torsten Seemann wrote:
>
> Dorjee,
>
>> thanks alot for your reply again. as per your suggestion (using 'die
>> "could
>> not get seq" if not defined $queryin;'), i now get the following error
>> message:
>> Software error:
>> could not get seq at /usr/local/apache2/htdocs/remote_ncbi.pl line 50.
>> i've attached the script. could you plz have a look at it and see where
>> am i
>> going wrong.
>> cheers mate!
>
> This strongly suggests that your FASTA file is not actually in FASTA
> format.
> http://en.wikipedia.org/wiki/Fasta_format
>
> Does it work if you pass it to blastall on the command line?
> eg. blastall -p blastp -i result/fasta.faa -d /export/home/database/nr
>
>> Saier Lab.
>> 858-534-2457
>
> Are you working at UCSD?
>
> --Torsten
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l at lists.open-bio.org
> http://lists.open-bio.org/mailman/listinfo/bioperl-l
>
>
--
View this message in context: http://www.nabble.com/blastall-problem-tf3527412.html#a9867402
Sent from the Perl - Bioperl-L mailing list archive at Nabble.com.
More information about the Bioperl-l
mailing list