Prodom multiple alignment format

From BioPerl
Jump to: navigation, search

Description

See http://protein.toulouse.inra.fr/prodom/2004.1/documentation/data.php

Example

ID 20167 p2002.1                           10 seq.
AC   PD266930
KW   FADR(2) Y586(1) // COMPLETE PROTEOME DNA-BINDING FATTY TRANSCRIPTION REGULATION METABOLISM REGULATOR ACID ACTIVATOR 
LA   74
ND   10
CC   -!- DIAMETER:      119 PAM
CC   -!- RADIUS OF GYRATION:    53 PAM
CC   -!- SEQUENCE CLOSEST TO CONSENSUS: Q8ZEL9_YERPE 5-78 (distance:15 PAM)
DC   This family was generated by psi-blast, with a profile built from the seed aligment of the following SCOP FAMILY
DC   a.4.5.6
AL P09371|FADR_ECOLI            4    77 0.22 AQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETS
AL Q8ZP15|Q8ZP15_SALTY          5    78 0.22 AQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETS
AL Q8ZEL9|Q8ZEL9_YERPE          5    78 0.22 AQSPAGFAEEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETS
AL Q8Z685|Q8Z685_SALTI          5    78 0.35 AQSPAGFAEEYIIESIWNNCFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETS
AL Q9KQU8|Q9KQU8_VIBCH          5    78 0.62 AKSPAGFAEKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNQFMETS
AL Q9CPJ0|Q9CPJ0_PASMU         10    83 0.77 AQSPAGLAEEYIVRSIWNNHFPPGSDLPAERELAEKIGVTRTTLREVLQRLARDGWLNIQHGKPTKVNNIWETS
AL P44705|FADR_HAEIN           10    81 1.08 AQSPAALAEEYIVKSIWQDVFPAGSNLPSERDLADKIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNIWD..
AL O07792|Y586_MYCTU           17    77 2.08 .........EQIATDVLTGEMPPGEALPSERRLAELLGVSRPAVREALKRLSAAGLVEVRQGDVTTVRDF....
AL Q11159|Y494_MYCTU           27    77 2.21 ...........IADAILDGVFPPGSTLPPERDLAERLGVNRTSLRQGLARLQQMGLIEVRHG............
AL Q8XFI2|Q8XFI2_SALTY         59   109 2.23 ...........IIKLINDNIFPPGTFLPPERELAKQLGVSRASLREALIVLEISGWIVIQSG............
CO                                           AQSPAGFAEEYIVKSIWDGVFPPGSTLPPERELAERLGVSRTSLREALQRLERDGWIEIQHGKPTKVNNFWETS
DR   INTERPRO;    IPR000524 "Bacterial regulatory proteins, GntR"
DR   PfamA;       PF00392 gntR
DR   PROSITE;     PS00043 PDOC00042 HTH_GNTR_FAMILY (27-51)
DR   PDB;         1H9T chain B  (5-78) Q8ZP15_SALTY (5-78),1HW1 chain A (5-78),1HW1 chain B (5-78)
DR   PDB;         1H9T chain A  (5-78) Q8ZP15_SALTY (5-78)
...
//
Personal tools
Namespaces
Variants
Actions
Main Links
documentation
community
development
Toolbox