Tab sequence format

From BioPerl
Jump to: navigation, search


Description

This simple format has two columns per line. The first column is a sequence identifier or description. The second column is the sequence itself. The columns are separated by a single tab ("\t") character.

This file format can be parsed by the Bio::SeqIO system using the Bio::SeqIO::tab module.

Example

roa1_drome	MVNSNQNLNGNSNGHDDDFPQDSITEPEHARKLFIGGLDYRTTDENLK
roa2_drome	MVNPNQNQNGNSNDHDDDFPQDSITEPEHMCKLFIGGLDYRTTDENLK
roa3_drome	MPNSNQNQNGNSNGHGDDFPQDSITEPEHMRKLFIGGLDYRTTDENLK
Personal tools
Namespaces
Variants
Actions
Main Links
documentation
community
development
Toolbox